SCOP 1.69: Domain d1sprd_: 1spr D:

Lineage for d1sprd_ (1spr D:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (30 proteins)
   Pfam 00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries)

8. Domain d1sprd_: 1spr D: [40432]

Details for d1sprd_

PDB Entry: 1spr, 2.5 Å

PDB Description: binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms

SCOP Domain Sequences for d1sprd_:

Sequence; same for both SEQRES and ATOM records:

>d1sprd_ d.93.1.1 (D:) c-src tyrosine kinase {Rous sarcoma virus}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

Timeline for d1sprd_:

• d1sprd_ first appeared (with stable ids) in SCOP 1.55
  
• d1sprd_ appears in SCOP 1.67
  
• d1sprd_ appears in SCOP 1.71
  
• d1sprd_ appears in the current release, SCOPe 2.08