Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (30 proteins) Pfam 00017 |
Protein c-src tyrosine kinase [55556] (3 species) |
Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries) |
Domain d1sprd_: 1spr D: [40432] |
PDB Entry: 1spr (more details), 2.5 Å
SCOP Domain Sequences for d1sprd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sprd_ d.93.1.1 (D:) c-src tyrosine kinase {Rous sarcoma virus} aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
Timeline for d1sprd_: