Lineage for d1sprc_ (1spr C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194873Fold d.93: SH2-like [55549] (1 superfamily)
  4. 194874Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 194875Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 194879Protein c-src tyrosine kinase [55556] (3 species)
  7. 194905Species Rous sarcoma virus [TaxId:11886] [69782] (9 PDB entries)
  8. 194916Domain d1sprc_: 1spr C: [40431]

Details for d1sprc_

PDB Entry: 1spr (more details), 2.5 Å

PDB Description: binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms

SCOP Domain Sequences for d1sprc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sprc_ d.93.1.1 (C:) c-src tyrosine kinase {Rous sarcoma virus}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

SCOP Domain Coordinates for d1sprc_:

Click to download the PDB-style file with coordinates for d1sprc_.
(The format of our PDB-style files is described here.)

Timeline for d1sprc_: