Lineage for d1sprc_ (1spr C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965246Protein c-src tyrosine kinase [55556] (4 species)
  7. 2965309Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries)
  8. 2965324Domain d1sprc_: 1spr C: [40431]
    complexed with po4

Details for d1sprc_

PDB Entry: 1spr (more details), 2.5 Å

PDB Description: binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms
PDB Compounds: (C:) src tyrosine kinase sh2 domain

SCOPe Domain Sequences for d1sprc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sprc_ d.93.1.1 (C:) c-src tyrosine kinase {Rous sarcoma virus [TaxId: 11886]}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

SCOPe Domain Coordinates for d1sprc_:

Click to download the PDB-style file with coordinates for d1sprc_.
(The format of our PDB-style files is described here.)

Timeline for d1sprc_: