Lineage for d1sprb_ (1spr B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82620Protein v-src tyrosine kinase [55554] (1 species)
  7. 82621Species Rous sarcoma virus, Schmidt-ruppin strain a [55555] (7 PDB entries)
  8. 82628Domain d1sprb_: 1spr B: [40430]

Details for d1sprb_

PDB Entry: 1spr (more details), 2.5 Å

PDB Description: binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms

SCOP Domain Sequences for d1sprb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sprb_ d.93.1.1 (B:) v-src tyrosine kinase {Rous sarcoma virus, Schmidt-ruppin strain a}
qaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

SCOP Domain Coordinates for d1sprb_:

Click to download the PDB-style file with coordinates for d1sprb_.
(The format of our PDB-style files is described here.)

Timeline for d1sprb_: