Lineage for d1spra_ (1spr A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260293Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 260294Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 260295Family d.93.1.1: SH2 domain [55551] (22 proteins)
  6. 260299Protein c-src tyrosine kinase [55556] (3 species)
  7. 260325Species Rous sarcoma virus [TaxId:11886] [69782] (9 PDB entries)
  8. 260334Domain d1spra_: 1spr A: [40429]

Details for d1spra_

PDB Entry: 1spr (more details), 2.5 Å

PDB Description: binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms

SCOP Domain Sequences for d1spra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spra_ d.93.1.1 (A:) c-src tyrosine kinase {Rous sarcoma virus}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

SCOP Domain Coordinates for d1spra_:

Click to download the PDB-style file with coordinates for d1spra_.
(The format of our PDB-style files is described here.)

Timeline for d1spra_: