Lineage for d1skj__ (1skj -)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194873Fold d.93: SH2-like [55549] (1 superfamily)
  4. 194874Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 194875Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 194879Protein c-src tyrosine kinase [55556] (3 species)
  7. 194905Species Rous sarcoma virus [TaxId:11886] [69782] (9 PDB entries)
  8. 194912Domain d1skj__: 1skj - [40427]

Details for d1skj__

PDB Entry: 1skj (more details), 2.1 Å

PDB Description: cocrystal structure of urea-substituted phosphopeptide complex

SCOP Domain Sequences for d1skj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skj__ d.93.1.1 (-) c-src tyrosine kinase {Rous sarcoma virus}
eewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

SCOP Domain Coordinates for d1skj__:

Click to download the PDB-style file with coordinates for d1skj__.
(The format of our PDB-style files is described here.)

Timeline for d1skj__: