SCOPe 2.05: Domain d1shaa_: 1sha A:

Lineage for d1shaa_ (1sha A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries)

8. Domain d1shaa_: 1sha A: [40424]

Details for d1shaa_

PDB Entry: 1sha, 1.5 Å

PDB Description: crystal structure of the phosphotyrosine recognition domain sh2 of v-src complexed with tyrosine-phosphorylated peptides

PDB Compounds: (A:) v-src sh2 domain

SCOPe Domain Sequences for d1shaa_:

Sequence; same for both SEQRES and ATOM records:

>d1shaa_ d.93.1.1 (A:) c-src tyrosine kinase {Rous sarcoma virus [TaxId: 11886]}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

Timeline for d1shaa_:

• d1shaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1shaa_ appears in SCOPe 2.04
  
• d1shaa_ appears in SCOPe 2.06
  
• d1shaa_ appears in the current release, SCOPe 2.08