Lineage for d1shaa_ (1sha A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965246Protein c-src tyrosine kinase [55556] (4 species)
  7. 2965309Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries)
  8. 2965310Domain d1shaa_: 1sha A: [40424]

Details for d1shaa_

PDB Entry: 1sha (more details), 1.5 Å

PDB Description: crystal structure of the phosphotyrosine recognition domain sh2 of v-src complexed with tyrosine-phosphorylated peptides
PDB Compounds: (A:) v-src sh2 domain

SCOPe Domain Sequences for d1shaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shaa_ d.93.1.1 (A:) c-src tyrosine kinase {Rous sarcoma virus [TaxId: 11886]}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

SCOPe Domain Coordinates for d1shaa_:

Click to download the PDB-style file with coordinates for d1shaa_.
(The format of our PDB-style files is described here.)

Timeline for d1shaa_: