SCOP 1.63: Domain d1fbzb_: 1fbz B:

Lineage for d1fbzb_ (1fbz B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (22 proteins)

6. Protein p56-lck tyrosine kinase [55552] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55553] (10 PDB entries)

8. Domain d1fbzb_: 1fbz B: [40423]
   complexed with cc1

Details for d1fbzb_

PDB Entry: 1fbz, 2.4 Å

PDB Description: Structure-based design of a novel, osteoclast-selective, nonpeptide Src SH2 inhibitor with in vivo anti-resorptive activity

SCOP Domain Sequences for d1fbzb_:

Sequence; same for both SEQRES and ATOM records:

>d1fbzb_ d.93.1.1 (B:) p56-lck tyrosine kinase {Human (Homo sapiens)}
epepwffknlsrkdaerqllapgnthgsfliresestagsfclsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

Timeline for d1fbzb_:

• d1fbzb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fbzb_ appears in SCOP 1.61
  
• d1fbzb_ appears in SCOP 1.65
  
• d1fbzb_ appears in the current release, SCOPe 2.08