Lineage for d1fbzb_ (1fbz B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194873Fold d.93: SH2-like [55549] (1 superfamily)
  4. 194874Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 194875Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 194982Protein p56-lck tyrosine kinase [55552] (1 species)
  7. 194983Species Human (Homo sapiens) [TaxId:9606] [55553] (10 PDB entries)
  8. 194996Domain d1fbzb_: 1fbz B: [40423]

Details for d1fbzb_

PDB Entry: 1fbz (more details), 2.4 Å

PDB Description: Structure-based design of a novel, osteoclast-selective, nonpeptide Src SH2 inhibitor with in vivo anti-resorptive activity

SCOP Domain Sequences for d1fbzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbzb_ d.93.1.1 (B:) p56-lck tyrosine kinase {Human (Homo sapiens)}
epepwffknlsrkdaerqllapgnthgsfliresestagsfclsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

SCOP Domain Coordinates for d1fbzb_:

Click to download the PDB-style file with coordinates for d1fbzb_.
(The format of our PDB-style files is described here.)

Timeline for d1fbzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fbza_