Lineage for d1fbzb_ (1fbz B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (19 proteins) Protein p56-lck tyrosine kinase [55552] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55553] (9 PDB entries) 
Domain d1fbzb_: 1fbz B: [40423]
Details for d1fbzb_
PDB Entry: 1fbz (more details), 2.4 Å
PDB Description: Structure-based design of a novel, osteoclast-selective, nonpeptide Src SH2 inhibitor with in vivo anti-resorptive activity
SCOP Domain Sequences for d1fbzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbzb_ d.93.1.1 (B:) p56-lck tyrosine kinase {Human (Homo sapiens)}
epepwffknlsrkdaerqllapgnthgsfliresestagsfclsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
SCOP Domain Coordinates for d1fbzb_:
Click to download the PDB-style file with coordinates for d1fbzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fbzb_:
- d1fbzb_ appears in SCOP 1.57
- d1fbzb_ appears in the current release, SCOPe 2.08
View in 3D
