SCOP 1.57: Domain d1lcka2: 1lck A:117-226

Lineage for d1lcka2 (1lck A:117-226)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (20 proteins)

6. Protein p56-lck tyrosine kinase [55552] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55553] (9 PDB entries)

8. Domain d1lcka2: 1lck A:117-226 [40421]
   Other proteins in same PDB: d1lcka1

Details for d1lcka2

PDB Entry: 1lck, 2.5 Å

PDB Description: sh3-sh2 domain fragment of human p56-lck tyrosine kinase complexed with the 10 residue synthetic phosphotyrosyl peptide tegqpyqpqpa

SCOP Domain Sequences for d1lcka2:

Sequence; same for both SEQRES and ATOM records:

>d1lcka2 d.93.1.1 (A:117-226) p56-lck tyrosine kinase {Human (Homo sapiens)}
akanslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqge
vvkhykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

Timeline for d1lcka2:

• d1lcka2 first appeared (with stable ids) in SCOP 1.55
  
• d1lcka2 appears in SCOP 1.59
  
• d1lcka2 appears in the current release, SCOPe 2.08