Lineage for d1bhha_ (1bhh A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. Protein p56-lck tyrosine kinase [55552] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [55553] (11 PDB entries)
  8. Domain d1bhha_: 1bhh A: [40416]

Details for d1bhha_

PDB Entry: 1bhh (more details), 1.9 Å

PDB Description: free p56lck sh2 domain
PDB Compounds: (A:) t-lymphocyte-specific protein tyrosine kinase p56lck

SCOPe Domain Sequences for d1bhha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhha_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

SCOPe Domain Coordinates for d1bhha_ are not available.

Timeline for d1bhha_:

Domains from other chains:
(mouse over for more information)
d1bhhb_