SCOPe 2.07: Domain d6wvzl2: 6wvz L:107-213

Lineage for d6wvzl2 (6wvz L:107-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6wvzl2: 6wvz L:107-213 [404151]
   Other proteins in same PDB: d6wvzl1, d6wvzm1, d6wvzm2, d6wvzm3
   automated match to d1dn0a2
   complexed with fmt, nag

Details for d6wvzl2

PDB Entry: 6wvz, 3.1 Å

PDB Description: crystal structure of anti-met fab arm of amivantamab in complex with human met

PDB Compounds: (L:) Light Chain of anti-MET Fab of amivantamab

SCOPe Domain Sequences for d6wvzl2:

Sequence; same for both SEQRES and ATOM records:

>d6wvzl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6wvzl2:

• d6wvzl2 is new in SCOPe 2.07-stable
  
• d6wvzl2 appears in the current release, SCOPe 2.08