Lineage for d1c7sa4 (1c7s A:201-337)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415443Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 415854Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 415855Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (3 proteins)
    family GH20
  6. 415856Protein Bacterial chitobiase, Domain 2 [55547] (1 species)
  7. 415857Species Serratia marcescens [TaxId:615] [55548] (4 PDB entries)
  8. 415859Domain d1c7sa4: 1c7s A:201-337 [40410]
    Other proteins in same PDB: d1c7sa1, d1c7sa2, d1c7sa3
    complexed with cbs, so4; mutant

Details for d1c7sa4

PDB Entry: 1c7s (more details), 1.8 Å

PDB Description: beta-n-acetylhexosaminidase mutant d539a complexed with di-n-acetyl- beta-d-glucosamine (chitobiase)

SCOP Domain Sequences for d1c7sa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7sa4 d.92.2.1 (A:201-337) Bacterial chitobiase, Domain 2 {Serratia marcescens}
snadlqtlpagalrgkivptpmqvkvhaqdadlrkgvaldlstlvkpaadvvsqrfallg
vpvqtngypiktdiqpgkfkgamavsgayelkigkkeaqvigfdqagvfyglqsilslvp
sdgsgkiatldasdapr

SCOP Domain Coordinates for d1c7sa4:

Click to download the PDB-style file with coordinates for d1c7sa4.
(The format of our PDB-style files is described here.)

Timeline for d1c7sa4: