Lineage for d1c7sa4 (1c7s A:201-337)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34517Superfamily d.92.2: Bacterial chitobiase, Domain 2 [55545] (1 family) (S)
  5. 34518Family d.92.2.1: Bacterial chitobiase, Domain 2 [55546] (1 protein)
  6. 34519Protein Bacterial chitobiase, Domain 2 [55547] (1 species)
  7. 34520Species Serratia marcescens [TaxId:615] [55548] (4 PDB entries)
  8. 34522Domain d1c7sa4: 1c7s A:201-337 [40410]
    Other proteins in same PDB: d1c7sa1, d1c7sa2, d1c7sa3

Details for d1c7sa4

PDB Entry: 1c7s (more details), 1.8 Å

PDB Description: beta-n-acetylhexosaminidase mutant d539a complexed with di-n-acetyl- beta-d-glucosamine (chitobiase)

SCOP Domain Sequences for d1c7sa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7sa4 d.92.2.1 (A:201-337) Bacterial chitobiase, Domain 2 {Serratia marcescens}
snadlqtlpagalrgkivptpmqvkvhaqdadlrkgvaldlstlvkpaadvvsqrfallg
vpvqtngypiktdiqpgkfkgamavsgayelkigkkeaqvigfdqagvfyglqsilslvp
sdgsgkiatldasdapr

SCOP Domain Coordinates for d1c7sa4:

Click to download the PDB-style file with coordinates for d1c7sa4.
(The format of our PDB-style files is described here.)

Timeline for d1c7sa4: