![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (3 proteins) family GH20 |
![]() | Protein Bacterial chitobiase, Domain 2 [55547] (1 species) |
![]() | Species Serratia marcescens [TaxId:615] [55548] (4 PDB entries) |
![]() | Domain d1qbb_4: 1qbb 201-337 [40409] Other proteins in same PDB: d1qbb_1, d1qbb_2, d1qbb_3 |
PDB Entry: 1qbb (more details), 2 Å
SCOP Domain Sequences for d1qbb_4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qbb_4 d.92.2.1 (201-337) Bacterial chitobiase, Domain 2 {Serratia marcescens} snadlqtlpagalrgkivptpmqvkvhaqdadlrkgvaldlstlvkpaadvvsqrfallg vpvqtngypiktdiqpgkfkgamavsgayelkigkkeaqvigfdqagvfyglqsilslvp sdgsgkiatldasdapr
Timeline for d1qbb_4: