Lineage for d1qbb_4 (1qbb 201-337)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34517Superfamily d.92.2: Bacterial chitobiase, Domain 2 [55545] (1 family) (S)
  5. 34518Family d.92.2.1: Bacterial chitobiase, Domain 2 [55546] (1 protein)
  6. 34519Protein Bacterial chitobiase, Domain 2 [55547] (1 species)
  7. 34520Species Serratia marcescens [TaxId:615] [55548] (4 PDB entries)
  8. 34523Domain d1qbb_4: 1qbb 201-337 [40409]
    Other proteins in same PDB: d1qbb_1, d1qbb_2, d1qbb_3

Details for d1qbb_4

PDB Entry: 1qbb (more details), 2 Å

PDB Description: bacterial chitobiase complexed with chitobiose (dinag)

SCOP Domain Sequences for d1qbb_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbb_4 d.92.2.1 (201-337) Bacterial chitobiase, Domain 2 {Serratia marcescens}
snadlqtlpagalrgkivptpmqvkvhaqdadlrkgvaldlstlvkpaadvvsqrfallg
vpvqtngypiktdiqpgkfkgamavsgayelkigkkeaqvigfdqagvfyglqsilslvp
sdgsgkiatldasdapr

SCOP Domain Coordinates for d1qbb_4:

Click to download the PDB-style file with coordinates for d1qbb_4.
(The format of our PDB-style files is described here.)

Timeline for d1qbb_4: