Lineage for d1qbba4 (1qbb A:201-337)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183652Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2184852Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2184853Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 protein domains)
    family GH20
  6. 2184854Protein Bacterial chitobiase, Domain 2 [55547] (1 species)
  7. 2184855Species Serratia marcescens [TaxId:615] [55548] (4 PDB entries)
  8. 2184858Domain d1qbba4: 1qbb A:201-337 [40409]
    Other proteins in same PDB: d1qbba1, d1qbba2, d1qbba3
    complexed with cbs, so4

Details for d1qbba4

PDB Entry: 1qbb (more details), 2 Å

PDB Description: bacterial chitobiase complexed with chitobiose (dinag)
PDB Compounds: (A:) chitobiase

SCOPe Domain Sequences for d1qbba4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbba4 d.92.2.1 (A:201-337) Bacterial chitobiase, Domain 2 {Serratia marcescens [TaxId: 615]}
snadlqtlpagalrgkivptpmqvkvhaqdadlrkgvaldlstlvkpaadvvsqrfallg
vpvqtngypiktdiqpgkfkgamavsgayelkigkkeaqvigfdqagvfyglqsilslvp
sdgsgkiatldasdapr

SCOPe Domain Coordinates for d1qbba4:

Click to download the PDB-style file with coordinates for d1qbba4.
(The format of our PDB-style files is described here.)

Timeline for d1qbba4: