SCOP 1.57: Domain d1buvm_: 1buv M:

Lineage for d1buvm_ (1buv M:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (8 proteins)

6. Protein Membrane-type matrix metalloproteinase (CDMT1-MMP) [55543] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55544] (2 PDB entries)

8. Domain d1buvm_: 1buv M: [40407]
   Other proteins in same PDB: d1buvt_

Details for d1buvm_

PDB Entry: 1buv, 2.75 Å

PDB Description: crystal structure of the mt1-mmp-timp-2 complex

SCOP Domain Sequences for d1buvm_:

Sequence; same for both SEQRES and ATOM records:

>d1buvm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens)}
iqglkwqhneitfciqnytpkvgeyatyeairkafrvwesatplrfrevpyayireghek
qadimiffaegfhgdstpfdgeggflahayfpgpniggdthfdsaepwtvrnedlngndi
flvavhelghalglehssdpsaimapfyqwmdtenfvlpdddrrgiqqlygges

Timeline for d1buvm_:

• d1buvm_ first appeared (with stable ids) in SCOP 1.55
  
• d1buvm_ appears in SCOP 1.59
  
• d1buvm_ appears in the current release, SCOPe 2.08