![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) |
![]() | Protein Membrane-type matrix metalloproteinase (CDMT1-MMP) [55543] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55544] (2 PDB entries) |
![]() | Domain d1buvm_: 1buv M: [40407] Other proteins in same PDB: d1buvt_ |
PDB Entry: 1buv (more details), 2.75 Å
SCOP Domain Sequences for d1buvm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buvm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens)} iqglkwqhneitfciqnytpkvgeyatyeairkafrvwesatplrfrevpyayireghek qadimiffaegfhgdstpfdgeggflahayfpgpniggdthfdsaepwtvrnedlngndi flvavhelghalglehssdpsaimapfyqwmdtenfvlpdddrrgiqqlygges
Timeline for d1buvm_: