Lineage for d1buvm_ (1buv M:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) 
Protein Membrane-type matrix metalloproteinase (CDMT1-MMP) [55543] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55544] (2 PDB entries) 
Domain d1buvm_: 1buv M: [40407]
Other proteins in same PDB: d1buvt_
Details for d1buvm_
PDB Entry: 1buv (more details), 2.75 Å
PDB Description: crystal structure of the mt1-mmp-timp-2 complex
SCOP Domain Sequences for d1buvm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buvm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens)}
iqglkwqhneitfciqnytpkvgeyatyeairkafrvwesatplrfrevpyayireghek
qadimiffaegfhgdstpfdgeggflahayfpgpniggdthfdsaepwtvrnedlngndi
flvavhelghalglehssdpsaimapfyqwmdtenfvlpdddrrgiqqlygges
SCOP Domain Coordinates for d1buvm_:
Click to download the PDB-style file with coordinates for d1buvm_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1buvm_:
- d1buvm_ appears in SCOP 1.57
- d1buvm_ appears in the current release, SCOPe 2.08
View in 3D
