![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein Membrane-type matrix metalloproteinase (CDMT1-MMP) [55543] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55544] (2 PDB entries) |
![]() | Domain d1buvm_: 1buv M: [40407] Other proteins in same PDB: d1buvt_ complexed with ca, zn |
PDB Entry: 1buv (more details), 2.75 Å
SCOPe Domain Sequences for d1buvm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buvm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} iqglkwqhneitfciqnytpkvgeyatyeairkafrvwesatplrfrevpyayireghek qadimiffaegfhgdstpfdgeggflahayfpgpniggdthfdsaepwtvrnedlngndi flvavhelghalglehssdpsaimapfyqwmdtenfvlpdddrrgiqqlygges
Timeline for d1buvm_: