Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
Protein automated matches [190951] (34 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [404012] (5 PDB entries) |
Domain d6xhsc_: 6xhs C: [404041] automated match to d2vsha_ complexed with ctp, mg, scn |
PDB Entry: 6xhs (more details), 2.9 Å
SCOPe Domain Sequences for d6xhsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xhsc_ c.68.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]} mkyagilaggigsrmgnvplpkqfldldnkpilihtlekfilindfekiiiatpqqwmth tkdtlrkfkisderieviqggsdrndtimnivkhiestngindddvivthdavrpflthr iikeniqaaleygavdtvidaidtivtskdnqtidaipvrnemyqgqtpqsfninllkes yaqlsdeqksilsdackiivetnkpvrlvkgelynikvttpydlkvanaiirggia
Timeline for d6xhsc_: