Lineage for d6xhsc_ (6xhs C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899417Species Staphylococcus aureus [TaxId:1280] [404012] (5 PDB entries)
  8. 2899436Domain d6xhsc_: 6xhs C: [404041]
    automated match to d2vsha_
    complexed with ctp, mg, scn

Details for d6xhsc_

PDB Entry: 6xhs (more details), 2.9 Å

PDB Description: crystal structure of s. aureus tari in complex with ctp (space group p1211)
PDB Compounds: (C:) Ribitol-5-phosphate cytidylyltransferase 1

SCOPe Domain Sequences for d6xhsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xhsc_ c.68.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkyagilaggigsrmgnvplpkqfldldnkpilihtlekfilindfekiiiatpqqwmth
tkdtlrkfkisderieviqggsdrndtimnivkhiestngindddvivthdavrpflthr
iikeniqaaleygavdtvidaidtivtskdnqtidaipvrnemyqgqtpqsfninllkes
yaqlsdeqksilsdackiivetnkpvrlvkgelynikvttpydlkvanaiirggia

SCOPe Domain Coordinates for d6xhsc_:

Click to download the PDB-style file with coordinates for d6xhsc_.
(The format of our PDB-style files is described here.)

Timeline for d6xhsc_: