Lineage for d1cxva_ (1cxv A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135687Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 135688Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 135817Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins)
  6. 135818Protein Collagenase-3 (MMP-13) [55540] (2 species)
  7. 135827Species Mouse (Mus musculus) [TaxId:10090] [55542] (1 PDB entry)
  8. 135828Domain d1cxva_: 1cxv A: [40404]

Details for d1cxva_

PDB Entry: 1cxv (more details), 2 Å

PDB Description: structure of recombinant mouse collagenase-3 (mmp-13)

SCOP Domain Sequences for d1cxva_:

Sequence, based on SEQRES records: (download)

>d1cxva_ d.92.1.11 (A:) Collagenase-3 (MMP-13) {Mouse (Mus musculus)}
ynvfprtlkwsqtnltyrivnytpdmshsevekafrkafkvwsdvtplnftriydgtadi
misfgtkehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlfivaahe
lghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqflyg

Sequence, based on observed residues (ATOM records): (download)

>d1cxva_ d.92.1.11 (A:) Collagenase-3 (MMP-13) {Mouse (Mus musculus)}
ynvfprtlkwsqtnltyrivnytpdmshsevekafrkafkvwsdvtplnftriydgtadi
misfgtkehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlfivaahe
lghslgldhskdpgalmfpiytytfmlpdddvqgiqflyg

SCOP Domain Coordinates for d1cxva_:

Click to download the PDB-style file with coordinates for d1cxva_.
(The format of our PDB-style files is described here.)

Timeline for d1cxva_: