Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) |
Protein Collagenase-3 (MMP-13) [55540] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55541] (2 PDB entries) |
Domain d456cb_: 456c B: [40403] |
PDB Entry: 456c (more details), 2.4 Å
SCOP Domain Sequences for d456cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d456cb_ d.92.1.11 (B:) Collagenase-3 (MMP-13) {Human (Homo sapiens)} lkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadimisfgik ehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaahefghslgl dhskdpgalmfpiytytgkshfmlpdddvqgiqslygpg
Timeline for d456cb_: