SCOPe 2.08: Domain d6wwoa2: 6wwo A:246-440

Lineage for d6wwoa2 (6wwo A:246-440)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

8. Domain d6wwoa2: 6wwo A:246-440 [404015]
   Other proteins in same PDB: d6wwoa1, d6wwob1, d6wwok1, d6wwok2
   automated match to d4i50a2
   complexed with anp, gdp, gtp, mg, ta1

Details for d6wwoa2

PDB Entry: 6wwo, 2.8 Å

PDB Description: kif14[391-748] - amp-pnp in complex with a microtubule

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6wwoa2:

Sequence; same for both SEQRES and ATOM records:

>d6wwoa2 d.79.2.1 (A:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d6wwoa2:

• d6wwoa2 first appeared in SCOPe 2.07