| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
| Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
| Protein automated matches [254617] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries) |
| Domain d6wkbb3: 6wkb B:252-395 [404002] automated match to d2hj2a3 complexed with edo, med, met, u4p |
PDB Entry: 6wkb (more details), 2.55 Å
SCOPe Domain Sequences for d6wkbb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wkbb3 d.130.1.0 (B:252-395) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iggpqgdagltgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglc
rrvlvqvsyaigvshplsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiy
qrtaayghfgrdsfpwevpkklky
Timeline for d6wkbb3: