Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [403917] (1 PDB entry) |
Domain d6wshb1: 6wsh B:1-189 [403994] Other proteins in same PDB: d6wsha2, d6wshb2 automated match to d1s8na_ complexed with gol, mg, na |
PDB Entry: 6wsh (more details), 2.12 Å
SCOPe Domain Sequences for d6wshb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wshb1 c.23.1.0 (B:1-189) automated matches {Enterococcus faecalis [TaxId: 1351]} mdgrivivddepitrldirdivieagyevvgeaadgfeaievckktqpdlvlmdiqmpil dglkagkkivqdqlassivflsaysdvqntdkakklgalgylvkpldeksliptiemsie rgkqtqlllsqidklslkleerkiiekakgilvkenhiseeeayqmlrtlsmnkrarmse iaelivmdd
Timeline for d6wshb1: