Lineage for d6wshb1 (6wsh B:1-189)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855942Species Enterococcus faecalis [TaxId:1351] [403917] (1 PDB entry)
  8. 2855944Domain d6wshb1: 6wsh B:1-189 [403994]
    Other proteins in same PDB: d6wsha2, d6wshb2
    automated match to d1s8na_
    complexed with gol, mg, na

Details for d6wshb1

PDB Entry: 6wsh (more details), 2.12 Å

PDB Description: crystal structure of eutv from enterococcus faecalis
PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d6wshb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wshb1 c.23.1.0 (B:1-189) automated matches {Enterococcus faecalis [TaxId: 1351]}
mdgrivivddepitrldirdivieagyevvgeaadgfeaievckktqpdlvlmdiqmpil
dglkagkkivqdqlassivflsaysdvqntdkakklgalgylvkpldeksliptiemsie
rgkqtqlllsqidklslkleerkiiekakgilvkenhiseeeayqmlrtlsmnkrarmse
iaelivmdd

SCOPe Domain Coordinates for d6wshb1:

Click to download the PDB-style file with coordinates for d6wshb1.
(The format of our PDB-style files is described here.)

Timeline for d6wshb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6wshb2