SCOPe 2.08: Domain d6uvfc1: 6uvf C:1-196

Lineage for d6uvfc1 (6uvf C:1-196)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)

8. Domain d6uvfc1: 6uvf C:1-196 [403990]
   Other proteins in same PDB: d6uvfa2, d6uvfb2, d6uvfc2, d6uvfd2, d6uvfh2, d6uvfj2, d6uvfk2, d6uvfl2
   automated match to d4z9vb_
   complexed with edo, qhs, so4

Details for d6uvfc1

PDB Entry: 6uvf, 2.24 Å

PDB Description: crystal structure of bcl-xl bound to compound 12: (r)-2-(3-([1,1'- biphenyl]-4-carbonyl)-3-(4-methylbenzyl)ureido)-3- ((cyclohexylmethyl)sulfonyl)propanoic acid

PDB Compounds: (C:) Bcl-2-like protein 1

SCOPe Domain Sequences for d6uvfc1:

Sequence; same for both SEQRES and ATOM records:

>d6uvfc1 f.1.4.1 (C:1-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelyg

Timeline for d6uvfc1:

• d6uvfc1 first appeared in SCOPe 2.07