Lineage for d1mmr__ (1mmr -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607753Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 607824Protein Matrilysin (MMP-7) [55538] (1 species)
  7. 607825Species Human (Homo sapiens) [TaxId:9606] [55539] (3 PDB entries)
  8. 607829Domain d1mmr__: 1mmr - [40399]
    complexed with ca, srs, zn

Details for d1mmr__

PDB Entry: 1mmr (more details), 2.3 Å

PDB Description: matrilysin complexed with sulfodiimine inhibitor

SCOP Domain Sequences for d1mmr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmr__ d.92.1.11 (-) Matrilysin (MMP-7) {Human (Homo sapiens)}
yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
elghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygkr

SCOP Domain Coordinates for d1mmr__:

Click to download the PDB-style file with coordinates for d1mmr__.
(The format of our PDB-style files is described here.)

Timeline for d1mmr__: