Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries) |
Domain d6x27b_: 6x27 B: [403984] automated match to d2x36c_ complexed with 1pe, bo2, gol |
PDB Entry: 6x27 (more details), 2.12 Å
SCOPe Domain Sequences for d6x27b_:
Sequence, based on SEQRES records: (download)
>d6x27b_ d.14.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ermydvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmkes ariaytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpv rqnlamtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglev hfvehyreifdiafp
>d6x27b_ d.14.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ermydvtppgvvmglawtamggstlfvetslrrdgslevtgqlgevmkesariaytfara flmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtgev sltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyreif diafp
Timeline for d6x27b_: