Lineage for d6x27b_ (6x27 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931010Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries)
  8. 2931020Domain d6x27b_: 6x27 B: [403984]
    automated match to d2x36c_
    complexed with 1pe, bo2, gol

Details for d6x27b_

PDB Entry: 6x27 (more details), 2.12 Å

PDB Description: lon protease proteolytic domain complexed with bortezomib
PDB Compounds: (B:) lon protease homolog, mitochondrial

SCOPe Domain Sequences for d6x27b_:

Sequence, based on SEQRES records: (download)

>d6x27b_ d.14.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ermydvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmkes
ariaytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpv
rqnlamtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglev
hfvehyreifdiafp

Sequence, based on observed residues (ATOM records): (download)

>d6x27b_ d.14.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ermydvtppgvvmglawtamggstlfvetslrrdgslevtgqlgevmkesariaytfara
flmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtgev
sltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyreif
diafp

SCOPe Domain Coordinates for d6x27b_:

Click to download the PDB-style file with coordinates for d6x27b_.
(The format of our PDB-style files is described here.)

Timeline for d6x27b_: