Lineage for d1mmpb_ (1mmp B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729341Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 729451Protein Matrilysin (MMP-7) [55538] (1 species)
  7. 729452Species Human (Homo sapiens) [TaxId:9606] [55539] (4 PDB entries)
  8. 729455Domain d1mmpb_: 1mmp B: [40398]
    complexed with ca, rss, zn

Details for d1mmpb_

PDB Entry: 1mmp (more details), 2.3 Å

PDB Description: matrilysin complexed with carboxylate inhibitor
PDB Compounds: (B:) gelatinase a

SCOP Domain Sequences for d1mmpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmpb_ d.92.1.11 (B:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]}
yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
elghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygk

SCOP Domain Coordinates for d1mmpb_:

Click to download the PDB-style file with coordinates for d1mmpb_.
(The format of our PDB-style files is described here.)

Timeline for d1mmpb_: