SCOP 1.55: Domain d1bm6__: 1bm6 -

Lineage for d1bm6__ (1bm6 -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (24 PDB entries)

8. Domain d1bm6__: 1bm6 - [40395]

Details for d1bm6__

PDB Entry: 1bm6

PDB Description: solution structure of the catalytic domain of human stromelysin-1 complexed to a potent non-peptidic inhibitor, nmr, 20 structures

SCOP Domain Sequences for d1bm6__:

Sequence; same for both SEQRES and ATOM records:

>d1bm6__ d.92.1.11 (-) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

Timeline for d1bm6__:

• d1bm6__ appears in SCOP 1.57
  
• d1bm6__ appears in the current release, SCOPe 2.08, called d1bm6a_