Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) |
Protein Stromelysin-1 (MMP-3) [55536] (1 species) |
Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (24 PDB entries) |
Domain d1bm6__: 1bm6 - [40395] |
PDB Entry: 1bm6 (more details)
SCOP Domain Sequences for d1bm6__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bm6__ d.92.1.11 (-) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast} frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet
Timeline for d1bm6__: