Lineage for d1bm6a_ (1bm6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964558Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 2964559Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. 2964626Domain d1bm6a_: 1bm6 A: [40395]
    complexed with ca, hav, msb, zn

Details for d1bm6a_

PDB Entry: 1bm6 (more details)

PDB Description: solution structure of the catalytic domain of human stromelysin-1 complexed to a potent non-peptidic inhibitor, nmr, 20 structures
PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d1bm6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bm6a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

SCOPe Domain Coordinates for d1bm6a_:

Click to download the PDB-style file with coordinates for d1bm6a_.
(The format of our PDB-style files is described here.)

Timeline for d1bm6a_: