Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.1: Ribokinase-like [53614] (10 proteins) automatically mapped to Pfam PF00294 |
Protein Ribokinase [53615] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [142709] (11 PDB entries) Uniprot Q9H477 15-322 |
Domain d6wk0c1: 6wk0 C:14-322 [403944] Other proteins in same PDB: d6wk0a2, d6wk0b2, d6wk0c2, d6wk0d2 automated match to d5c3ya_ complexed with acp, na, rib |
PDB Entry: 6wk0 (more details), 2 Å
SCOPe Domain Sequences for d6wk0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wk0c1 c.72.1.1 (C:14-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} evaavvvvgscmtdlvsltsrlpktgetihghkffigfggkganqcvqaarlgamtsmvc kvgkdsfgndyienlkqndisteftyqtkdaatgtasiivnnegqniivivaganlllnt edlraaanvisrakvmvcqleitpatslealtmarrsgvktlfnpapaiadldpqfytls dvfccneseaeiltgltvgsaadageaalvllkrgcqvviitlgaegcvvlsqtepepkh iptekvkavdttgagdsfvgalafylayypnlsledmlnrsnfiaavsvqaagtqssypy kkdlpltlf
Timeline for d6wk0c1: