SCOPe 2.07: Domain d7o74b2: 7o74 B:87-156

Lineage for d7o74b2 (7o74 B:87-156)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
   intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families)
   automatically mapped to Pfam PF02560

5. Family d.72.1.0: automated matches [271343] (1 protein)
   not a true family

6. Protein automated matches [271344] (3 species)
   not a true protein

7. Species Pseudomonas lactis [TaxId:1615674] [403795] (1 PDB entry)

8. Domain d7o74b2: 7o74 B:87-156 [403916]
   Other proteins in same PDB: d7o74a1, d7o74b1, d7o74c1, d7o74d1, d7o74e1, d7o74f1, d7o74g1, d7o74h1, d7o74i1, d7o74j1
   automated match to d6b6ma2
   complexed with cl

Details for d7o74b2

PDB Entry: 7o74, 1.61 Å

PDB Description: structure of cyanase from pseudomonas lactis

PDB Compounds: (B:) cyanate hydratase

SCOPe Domain Sequences for d7o74b2:

Sequence; same for both SEQRES and ATOM records:

>d7o74b2 d.72.1.0 (B:87-156) automated matches {Pseudomonas lactis [TaxId: 1615674]}
gvptdptmyrfyemlqvygstlkalvheqfgdgiisainfkldikkvedpdggsravitl
dgkylptkpf

Timeline for d7o74b2:

• d7o74b2 is new in SCOPe 2.07-stable
  
• d7o74b2 appears in the current release, SCOPe 2.08