Lineage for d6uvhc_ (6uvh C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021136Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 3021137Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)
  8. 3021163Domain d6uvhc_: 6uvh C: [403910]
    Other proteins in same PDB: d6uvha2
    automated match to d4z9vb_
    complexed with edo, qhj, so4

Details for d6uvhc_

PDB Entry: 6uvh (more details), 2.19 Å

PDB Description: crystal structure of bcl-xl bound to compound 15: (r)-2-(3-(2-((4'- chloro-[1,1'-biphenyl]-2-yl)methyl)-1,2,3,4-tetrahydroisoquinoline-6- carbonyl)-3-(4-methylbenzyl)ureido)-3-((cyclohexylmethyl)sulfonyl) propanoic acid
PDB Compounds: (C:) Bcl-2-like protein 1

SCOPe Domain Sequences for d6uvhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uvhc_ f.1.4.1 (C:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelyg

SCOPe Domain Coordinates for d6uvhc_:

Click to download the PDB-style file with coordinates for d6uvhc_.
(The format of our PDB-style files is described here.)

Timeline for d6uvhc_: