Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein Apoptosis regulator Bcl-xL [56856] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries) |
Domain d6uvhc_: 6uvh C: [403910] Other proteins in same PDB: d6uvha2 automated match to d4z9vb_ complexed with edo, qhj, so4 |
PDB Entry: 6uvh (more details), 2.19 Å
SCOPe Domain Sequences for d6uvhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uvhc_ f.1.4.1 (C:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]} msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd hlepwiqenggwdtfvelyg
Timeline for d6uvhc_:
View in 3D Domains from other chains: (mouse over for more information) d6uvha1, d6uvha2, d6uvhb_, d6uvhd_ |