Lineage for d1c8tb_ (1c8t B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (24 PDB entries) 
Domain d1c8tb_: 1c8t B: [40391]
Details for d1c8tb_
PDB Entry: 1c8t (more details), 2.6 Å
PDB Description: human stromelysin-1 (e202q) catalytic domain complexed with ro-26-2812
SCOP Domain Sequences for d1c8tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8tb_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
fpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimis
favrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahqigh
slglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdp
SCOP Domain Coordinates for d1c8tb_:
Click to download the PDB-style file with coordinates for d1c8tb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c8tb_:
- d1c8tb_ appears in SCOP 1.57
- d1c8tb_ appears in the current release, SCOPe 2.08
View in 3D
