Lineage for d1c8tb_ (1c8t B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529558Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2529873Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 2529874Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. 2529930Domain d1c8tb_: 1c8t B: [40391]
    complexed with ca, tr1, zn

Details for d1c8tb_

PDB Entry: 1c8t (more details), 2.6 Å

PDB Description: human stromelysin-1 (e202q) catalytic domain complexed with ro-26-2812
PDB Compounds: (B:) stromelysin-1

SCOPe Domain Sequences for d1c8tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8tb_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
fpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimis
favrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahqigh
slglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdp

SCOPe Domain Coordinates for d1c8tb_:

Click to download the PDB-style file with coordinates for d1c8tb_.
(The format of our PDB-style files is described here.)

Timeline for d1c8tb_: