SCOPe 2.08: Domain d6uvgg1: 6uvg G:1-196

Lineage for d6uvgg1 (6uvg G:1-196)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)

8. Domain d6uvgg1: 6uvg G:1-196 [403885]
   Other proteins in same PDB: d6uvga2, d6uvgb2, d6uvgd2, d6uvgg2, d6uvgh2, d6uvgk2, d6uvgl2
   automated match to d4z9vb_
   complexed with edo, qhp, so4

Details for d6uvgg1

PDB Entry: 6uvg, 2.1 Å

PDB Description: crystal structure of bcl-xl bound to compound 13: (r)-2-(3-([1,1'- biphenyl]-4-carbonyl)-3-(4-methylbenzyl)ureido)-3-(((3r,5r,7r)- adamantan-1-ylmethyl)sulfonyl)propanoic acid

PDB Compounds: (G:) Bcl-2-like protein 1

SCOPe Domain Sequences for d6uvgg1:

Sequence; same for both SEQRES and ATOM records:

>d6uvgg1 f.1.4.1 (G:1-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelyg

Timeline for d6uvgg1:

• d6uvgg1 first appeared in SCOPe 2.07