SCOPe 2.07: Domain d7o74g1: 7o74 G:1-86

Lineage for d7o74g1 (7o74 G:1-86)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (17 species)
   not a true protein

7. Species Pseudomonas lactis [TaxId:1615674] [403793] (1 PDB entry)

8. Domain d7o74g1: 7o74 G:1-86 [403850]
   Other proteins in same PDB: d7o74a2, d7o74b2, d7o74c2, d7o74d2, d7o74e2, d7o74f2, d7o74g2, d7o74h2, d7o74i2, d7o74j2
   automated match to d6b6ma1
   complexed with cl

Details for d7o74g1

PDB Entry: 7o74, 1.61 Å

PDB Description: structure of cyanase from pseudomonas lactis

PDB Compounds: (G:) cyanate hydratase

SCOPe Domain Sequences for d7o74g1:

Sequence; same for both SEQRES and ATOM records:

>d7o74g1 a.35.1.0 (G:1-86) automated matches {Pseudomonas lactis [TaxId: 1615674]}
mlqsqfaqtprlaladtvidlkarknlswqaltdgtglslafvtaallgqhplpkeaadi
vcgklgldedasrllqsvplrgsfps

Timeline for d7o74g1:

• d7o74g1 is new in SCOPe 2.07-stable
  
• d7o74g1 appears in the current release, SCOPe 2.08