SCOP 1.67: Domain d1biwb_: 1biw B:

Lineage for d1biwb_ (1biw B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (31 PDB entries)

8. Domain d1biwb_: 1biw B: [40385]
   complexed with ca, s80, zn

Details for d1biwb_

PDB Entry: 1biw, 2.5 Å

PDB Description: design and synthesis of conformationally-constrained mmp inhibitors

SCOP Domain Sequences for d1biwb_:

Sequence; same for both SEQRES and ATOM records:

>d1biwb_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

Timeline for d1biwb_:

• d1biwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1biwb_ appears in SCOP 1.65
  
• d1biwb_ appears in SCOP 1.69
  
• d1biwb_ appears in the current release, SCOPe 2.08