Lineage for d7o0tb_ (7o0t B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2828459Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2828460Protein automated matches [190048] (31 species)
    not a true protein
  7. 2828558Species Chloroflexus aggregans [TaxId:326427] [403774] (1 PDB entry)
  8. 2828560Domain d7o0tb_: 7o0t B: [403783]
    automated match to d3hgja_
    complexed with fmn, mli

Details for d7o0tb_

PDB Entry: 7o0t (more details), 2.4 Å

PDB Description: crystal structure of chloroflexus aggregans ene-reductase caoye holoenzyme
PDB Compounds: (B:) NADH:flavin oxidoreductase/NADH oxidase

SCOPe Domain Sequences for d7o0tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7o0tb_ c.1.4.0 (B:) automated matches {Chloroflexus aggregans [TaxId: 326427]}
mqphlftpltigsvtlrnrigmspmcqysavdgfptdwhlmhlgaraaggvgliileata
vspegrispfdlgiwsddhiaalsrivklieslgavagiqlahagrkasvgrpweggkpi
apanggwpvvgptaepfapgyptpipldaagiarvvadfatatkraraagfrwieihaah
gyllhnflsplgndrndeyggdlrgrvrllsevtaavraewpsdlplavrlscsdwtpeg
ltiadtvevarmlreqgvdlidcssggiapgitipvgegyqvpfaaqvrreaniataavg
litrpehadaivrngdadlvllgrellrdphwplraaralghdlapppqylraw

SCOPe Domain Coordinates for d7o0tb_:

Click to download the PDB-style file with coordinates for d7o0tb_.
(The format of our PDB-style files is described here.)

Timeline for d7o0tb_: