Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Chloroflexus aggregans [TaxId:326427] [403774] (1 PDB entry) |
Domain d7o0tb_: 7o0t B: [403783] automated match to d3hgja_ complexed with fmn, mli |
PDB Entry: 7o0t (more details), 2.4 Å
SCOPe Domain Sequences for d7o0tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7o0tb_ c.1.4.0 (B:) automated matches {Chloroflexus aggregans [TaxId: 326427]} mqphlftpltigsvtlrnrigmspmcqysavdgfptdwhlmhlgaraaggvgliileata vspegrispfdlgiwsddhiaalsrivklieslgavagiqlahagrkasvgrpweggkpi apanggwpvvgptaepfapgyptpipldaagiarvvadfatatkraraagfrwieihaah gyllhnflsplgndrndeyggdlrgrvrllsevtaavraewpsdlplavrlscsdwtpeg ltiadtvevarmlreqgvdlidcssggiapgitipvgegyqvpfaaqvrreaniataavg litrpehadaivrngdadlvllgrellrdphwplraaralghdlapppqylraw
Timeline for d7o0tb_: