Lineage for d1b8ya_ (1b8y A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82192Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 82193Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) (S)
  5. 82321Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (8 proteins)
  6. 82380Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 82381Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (25 PDB entries)
  8. 82389Domain d1b8ya_: 1b8y A: [40377]

Details for d1b8ya_

PDB Entry: 1b8y (more details), 2 Å

PDB Description: x-ray structure of human stromelysin catalytic domain complexed with non-peptide inhibitors: implications for inhibitor selectivity

SCOP Domain Sequences for d1b8ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ya_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpp

SCOP Domain Coordinates for d1b8ya_:

Click to download the PDB-style file with coordinates for d1b8ya_.
(The format of our PDB-style files is described here.)

Timeline for d1b8ya_: