Lineage for d1ciza_ (1ciz A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (24 PDB entries) 
Domain d1ciza_: 1ciz A: [40371]
Details for d1ciza_
PDB Entry: 1ciz (more details), 1.64 Å
PDB Description: x-ray structure of human stromelysin catalytic domain complexes with non-peptide inhibitors: implication for inhibitor selectivity
SCOP Domain Sequences for d1ciza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ciza_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp
SCOP Domain Coordinates for d1ciza_:
Click to download the PDB-style file with coordinates for d1ciza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ciza_:
- d1ciza_ appears in SCOP 1.57
- d1ciza_ appears in the current release, SCOPe 2.08
View in 3D