Lineage for d1ciza_ (1ciz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964558Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 2964559Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. 2964572Domain d1ciza_: 1ciz A: [40371]
    complexed with ca, dps, so4, zn

Details for d1ciza_

PDB Entry: 1ciz (more details), 1.64 Å

PDB Description: x-ray structure of human stromelysin catalytic domain complexes with non-peptide inhibitors: implication for inhibitor selectivity
PDB Compounds: (A:) protein (stromelysin-1)

SCOPe Domain Sequences for d1ciza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciza_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

SCOPe Domain Coordinates for d1ciza_:

Click to download the PDB-style file with coordinates for d1ciza_.
(The format of our PDB-style files is described here.)

Timeline for d1ciza_: