SCOPe 2.07: Domain d7m7wd2: 7m7w D:114-216

Lineage for d7m7wd2 (7m7w D:114-216)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d7m7wd2: 7m7w D:114-216 [403697]
Other proteins in same PDB: d7m7wb1, d7m7wd1, d7m7wf1, d7m7wl1, d7m7wr_, d7m7ws_
automated match to d2fb4l2
complexed with nag

Details for d7m7wd2

PDB Entry: 7m7w (more details), 2.65 Å

PDB Description: antibodies to the sars-cov-2 receptor-binding domain that maximize breadth and resistance to viral escape

PDB Compounds: (D:) Monoclonal antibody S2H97 Fab light chain

SCOPe Domain Sequences for d7m7wd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m7wd2 b.1.1.2 (D:114-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d7m7wd2:

Click to download the PDB-style file with coordinates for d7m7wd2.
(The format of our PDB-style files is described here.)

Timeline for d7m7wd2: