Lineage for d7nbib1 (7nbi B:1-134)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2318797Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2318965Protein automated matches [190501] (4 species)
    not a true protein
  7. 2318966Species Human (Homo sapiens) [TaxId:9606] [187448] (23 PDB entries)
  8. 2318969Domain d7nbib1: 7nbi B:1-134 [403664]
    Other proteins in same PDB: d7nbib2
    automated match to d1etea_
    complexed with so4

Details for d7nbib1

PDB Entry: 7nbi (more details), 1.65 Å

PDB Description: crystal structure of a monomeric flt3 ligand variant
PDB Compounds: (B:) Fms-related tyrosine kinase 3 ligand

SCOPe Domain Sequences for d7nbib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nbib1 a.26.1.2 (B:1-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqdcsfqhspissdfavkirelsdyldqdypvtvasnlqdeelcgglwrlvlaqrwmerl
ktvagskmqgllervnteihfvtkcafqpppsclrfvqtnisrllqetseqlvalkpwit
rqnfsrclelqcqp

SCOPe Domain Coordinates for d7nbib1:

Click to download the PDB-style file with coordinates for d7nbib1.
(The format of our PDB-style files is described here.)

Timeline for d7nbib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7nbib2
View in 3D
Domains from other chains:
(mouse over for more information)
d7nbia_