![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins) |
![]() | Protein Stromelysin-1 (MMP-3) [55536] (1 species) |
![]() | Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (35 PDB entries) |
![]() | Domain d1ueac_: 1uea C: [40366] Other proteins in same PDB: d1ueab_, d1uead_ complexed with ca, zn; mutant |
PDB Entry: 1uea (more details), 2.8 Å
SCOP Domain Sequences for d1ueac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ueac_ d.92.1.11 (C:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp
Timeline for d1ueac_: