Lineage for d1ueac_ (1uea C:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867875Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 868041Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 868042Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (35 PDB entries)
  8. 868088Domain d1ueac_: 1uea C: [40366]
    Other proteins in same PDB: d1ueab_, d1uead_
    complexed with ca, zn; mutant

Details for d1ueac_

PDB Entry: 1uea (more details), 2.8 Å

PDB Description: mmp-3/timp-1 complex
PDB Compounds: (C:) Matrix metalloproteinase-3

SCOP Domain Sequences for d1ueac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ueac_ d.92.1.11 (C:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

SCOP Domain Coordinates for d1ueac_:

Click to download the PDB-style file with coordinates for d1ueac_.
(The format of our PDB-style files is described here.)

Timeline for d1ueac_: