Lineage for d1ueac_ (1uea C:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (24 PDB entries) 
Domain d1ueac_: 1uea C: [40366]
Other proteins in same PDB: d1ueab_, d1uead_
Details for d1ueac_
PDB Entry: 1uea (more details), 2.8 Å
PDB Description: mmp-3/timp-1 complex
SCOP Domain Sequences for d1ueac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ueac_ d.92.1.11 (C:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp
SCOP Domain Coordinates for d1ueac_:
Click to download the PDB-style file with coordinates for d1ueac_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ueac_:
- d1ueac_ appears in SCOP 1.57
- d1ueac_ appears in the current release, SCOPe 2.08
View in 3D
